« Back
Home /
TRIB3 Antibody

TRIB3 Antibody

Item no.	OAAL00771
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Aging & Neurological Disorders Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Myeloma Melanoma Sarcoma Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Western Blot ELISA Immunofluorescence Primary Antibodies CHiP Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IF, ELISA
Clone	1H2
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	C20orf97;neuronal cell death inducible putative kinase;NIPK;p65-interacting inhibitor of NF-kappaB;p65-interacting inhibitor of NF-kappa-B;SINK;SKIP3;TRB3;TRB-3;tribbles homolog 3.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	TRIB3
Gene Fullname	tribbles pseudokinase 3
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. [provided by RefSeq
Nucleotide accession_num	BC027484
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH27484
Protein name	Homo sapiens tribbles homolog 3 (Drosophila), mRNA (cDNA clone MGC:34909 IMAGE:5104452), complete cds\|Tribbles homolog 3 (Drosophila) [Homo sapiens]
Clonality	Monoclonal
Immunogen	TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00771-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer