« Back
Home /
MS4A7 Antibody

MS4A7 Antibody

Item no.	OAAL00775
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Western Blot ELISA Primary Antibodies CHiP Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	2D3
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	4SPAN2;CD20 antigen-like 4;CD20/Fc-epsilon-RI-beta family member 4;CD20L4;CFFM4;four-span transmembrane protein 2;high affinity immunoglobulin epsilon receptor beta subunit;membrane-spanning 4-domains subfamily A member 7;MS4A8.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	MS4A7
Gene Fullname	membrane spanning 4-domains A7
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq
Nucleotide accession_num	BC020673
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH20673
Protein name	Homo sapiens membrane-spanning 4-domains, subfamily A, member 7, mRNA (cDNA clone MGC:22368 IMAGE:4720044), complete cds\|Membrane-spanning 4-domains, subfamily A, member 7 [Homo sapiens]
Clonality	Monoclonal
Immunogen	MS4A7 (AAH20673, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00775-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer