« Back
Home /
TSKS Antibody

TSKS Antibody

Item no.	OAAL00781
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Cell Biology Cytoskeleton Western Blot ELISA Primary Antibodies Immunostaining small GTPases Ras Subfamily
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	2000000000
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	ALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDH
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	PPP1R161;protein phosphatase 1,regulatory subunit 161;STK22 substrate 1;STK22S1;testis specific serine/threonine kinase substrate;testis-specific kinase substrate;testis-specific serine kinase substrate;TSKS1;TSSKS.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	TSKS
Gene Fullname	testis specific serine kinase substrate
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression. [provided by RefSeq
Nucleotide accession_num	NM_021733
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_068379
Protein name	Homo sapiens testis specific serine kinase substrate (TSKS), mRNA\|testis-specific serine kinase substrate [Homo sapiens]
Clonality	Monoclonal
Immunogen	TSKS (NP_068379, 471 a.a. ~ 560 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00781-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer