« Back
Home /
ZSCAN16 Antibody

ZSCAN16 Antibody

Item no.	OAAL00831
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Targets for Rodent Neurosciences Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	4A9
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	GNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQ
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	dJ265C24.3;zinc finger and SCAN domain-containing protein 16;zinc finger protein 392;zinc finger protein 435;ZNF392;ZNF435.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	ZSCAN16
Gene Fullname	zinc finger and SCAN domain containing 16
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_025231
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_079507.1
Protein name	Homo sapiens zinc finger and SCAN domain containing 16 (ZSCAN16), transcript variant 1, mRNA\|zinc finger and SCAN domain-containing protein 16 isoform a [Homo sapiens]
Clonality	Monoclonal
Immunogen	ZNF435 (NP_079507.1, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00831-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Compare

Add to wishlist

Get an offer

Request delivery time