« Back
Home /
MYLK2 Antibody

MYLK2 Antibody

Item no.	OAAL00866
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Western Blot ELISA Primary Antibodies CHiP Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	2G1
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	KLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDC
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	KMLC;MLCK;MLCK2;myosin light chain kinase 2,skeletal muscle;myosin light chain kinase 2,skeletal/cardiac muscle;skMLCK.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	MYLK2
Gene Fullname	myosin light chain kinase 2
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes a myosin light chain kinase, a calcium/calmodulin dependent enzyme, that is exclusively expressed in adult skeletal muscle. [provided by RefSeq
Nucleotide accession_num	NM_033118
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_149109
Protein name	Homo sapiens myosin light chain kinase 2 (MYLK2), mRNA\|myosin light chain kinase 2, skeletal/cardiac muscle [Homo sapiens]
Clonality	Monoclonal
Immunogen	MYLK2 (NP_149109, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00866-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer