« Back
Home /
C9ORF96 Antibody

C9ORF96 Antibody

Item no.	OAAL00952
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Western Blot ELISA Primary Antibodies CHiP Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	2B5
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEI
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	C9orf96;probable inactive protein kinase-like protein SgK071;serine/threonine kinase-like domain-containing protein 1;serine/threonine kinase-like domain-containing protein STKLD1;SgK071;Sk521;sugen kinase 071.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	STKLD1
Gene Fullname	serine/threonine kinase like domain containing 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_153710
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_714921
Protein name	Homo sapiens serine/threonine kinase like domain containing 1 (STKLD1), transcript variant 1, mRNA\|serine/threonine kinase-like domain-containing protein STKLD1 [Homo sapiens]
Clonality	Monoclonal
Immunogen	C9orf96 (NP_714921, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00952-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer