« Back
Home /
PPARG Antibody

PPARG Antibody

Item no.	OAAN00069-100UL
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Antibodies By Cell Type Carcinoma Immunohistochemistry Western Blot ELISA Immunofluorescence Cardiovascular Research Atherosclerosis Primary Antibodies Other Lipid\Cholesterol Metabolism Modulators
Format	Liquid
Applications	WB, IF, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
Alias	GLM1,CIMT1,NR1C3,PPARG1,PPARG2,PPARG5,PPARgamma
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	58 kDa
Manufacturer - Application Additional Information	WB: 1:500~2000 IHC: 1:50~200 IF: 1:50~200
Gene symbol	PPARG
Gene Fullname	peroxisome proliferator activated receptor gamma
Product format	Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Reconstitution and storage	Store at -20C. Avoid repeated freeze/thaw cycles.
Description of target	This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.
Nucleotide accession_num	NM_005037.5
Protein accession_num	NP_005028.4
Protein name	Peroxisome proliferator-activated receptor gamma
Clonality	Polyclonal
Purification	Affinity purified against immunogen
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARG (NP_056953.2).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAN00069-100UL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer