Comparison

ERBB3 Antibody

Item no. OAAN00137-100UL
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Sequence SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEP
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias HER3,FERLK,LCCS2,ErbB-3,c-erbB3,erbB3-S,MDA-BF-1,c-erbB-3,p180-ErbB3,p45-sErbB3,p85-sErbB3
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
148 kDa
Manufacturer - Application Additional Information
WB: 1:500~2000
Gene symbol
ERBB3
Gene Fullname
erb-b2 receptor tyrosine kinase 3
Product format
Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Reconstitution and storage
Store at -20C. Avoid repeated freeze/thaw cycles.
Description of target
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Nucleotide accession_num
NM_001005915.1
Protein accession_num
NP_001005915.1
Protein name
Receptor tyrosine-protein kinase erbB-3
Clonality
Polyclonal
Purification
Affinity purification
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-285 of human ERBB3 (NP_001973.2).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close