Comparison

RBBP7 Antibody

Item no. OAAN02075-100UL
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IF, IP, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Sequence MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVE
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RbAp46
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
48 kDa
Manufacturer - Application Additional Information
WB: 1:500~2000
IF: 1:50~100
IP: 1:50~200
CHIP: 1:50~200
Gene symbol
RBBP7
Gene Fullname
retinoblastoma binding protein 7
Product format
Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Reconstitution and storage
Store at -20C. Avoid repeated freeze/thaw cycles.
Description of target
This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene.
Nucleotide accession_num
NM_001198719.1
Protein accession_num
NP_001185648.1
Protein name
Histone-binding protein RBBP7
Clonality
Polyclonal
Purification
Affinity purified against immunogen
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RBBP7 (NP_002884.1).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close