« Back
Home /
PAX6 Antibody

PAX6 Antibody

Item no.	OAAN02229-100UL
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Neural Lineage Markers Neural Transcription Factors Molecular Targets for Neuroscience Neural Development Antibodies Cell Biology Cytoskeleton Immunohistochemistry Immunoprecipitation Western Blot Immunofluorescence Immunocytochemistry Primary Antibodies Immunochemistry small GTPases Rho Subfamily
Format	Liquid
Applications	WB, IF, IP, IHC, ICC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	ISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASN
Alias	AN,AN1,AN2,FVH1,MGDA,WAGR,ASGD5,D11S812E
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	47 kDa
Manufacturer - Application Additional Information	WB: 1:500~1000IF/ICC: 1:50~200IP: 1:50~200
Gene symbol	PAX6
Gene Fullname	paired box 6
Product format	Liquid PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Reconstitution and storage	Store at -20°C. Avoid repeated freeze/thaw cycles.
Description of target	This gene encodes a homeobox and paired domain-containing protein that binds DNA and functions as a regulator of transcription. Activity of this protein is key in the development of neural tissues, particularly the eye. This gene is regulated by multiple enhancers located up to hundreds of kilobases distant from this locus. Mutations in this gene or in the enhancer regions can cause ocular disorders such as aniridia and Peter' s anomaly. Use of alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms.
Nucleotide accession_num	NM_000280.4
Protein accession_num	NP_000271.1
Protein name	Paired box protein Pax-6
Clonality	Polyclonal
Purification	Affinity purified against immunogen
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 190-280 of human PAX6 (NP_000271.1).
Storage Buffer	PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAN02229-100UL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer