« Back
Home /
BECN1 Antibody

BECN1 Antibody

Item no.	OAAN02239
Manufacturer	AVIVA Systems Biology
Amount	50 ul
Category	Oncology Neuroscience Neural Lineage Markers Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Necrosis Apoptosis Adenocarcinoma Cytoskeleton Mesothelioma Immunohistochemistry Immunoprecipitation Western Blot ELISA Immunofluorescence Autophagy Cardiovascular Research Proliferation Myocardial Infarction Motor proteins Primary Antibodies By Organ Colorectal Cancer Testicular & Prostate Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IF, IP, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMR
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ATG6,VPS30,beclin1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	52 kDa
Manufacturer - Application Additional Information	WB: 1:500 - 1:2000IHC: 1:50 - 1:200IF: 1:50 - 1:200IP: 1:50 - 1:100Optimal dilutions should be determined by the end user.
Gene symbol	BECN1
Gene Fullname	beclin 1
Product format	Liquid PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Reconstitution and storage	Store at -20°C. Avoid repeated freeze/thaw cycles.
Description of target	This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.
Nucleotide accession_num	NM_001313998.1
Protein accession_num	NP_001300927.1
Protein name	Beclin-1
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAN02239-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer