CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15)

Antibodies / Antibodies-Protein Kinases

-20°C

Supplied as a liquid in PBS, pH 7.2.

Full length human CDK7, aa1-346 (NP_001790.1).

CDK7, a CDC2/CDK type protein kinase, is the catalytic component of the Cdk-activating kinase (CAK) which acts as a regulator of cell cycle progression. CDK7 complexes with cyclin H and MAT1 to form CAK, and this multi-subunit protein phosphorylates the cyclin-dependent protein kinases CDC2/CDK1, CDK2, CDK4 and CDK6. CAK also associates with the transcription factor IIH (TFIIH) which functions in transcription initiation and DNA repair. TFIIH has been shown to be regulated by CDK8/cyclin C.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.