ATPase H+ Transporting Lysosomal Accessory Protein 1 (ATP6AP1,16A,Ac45,ATPase H+ Transporting Lysosomal (Vacuolar Proton Pump) Subunit 1,ATP6S1,ATPase H+ Transporting Lysosomal Interacting Protein 1,ATP6IP1,CF2,H-ATPase

Mab

MaxLight 550

4°C Do Not Freeze

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Partial recombinant protein corresponding to a portion of corresponding to a portion of amino acids within aa51-151 of human ATP6AP1 (NP_001174), with GST tag. MW of GST tag alone is 26kD.

MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150, 000.

This gene encodes a component of a multisubunit enzyme (1mD MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq]

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.