Comparison

Anti-MAPK14 Antibody [Assigned #A10832] European Partner

Item no. ANTI-A13090-100
Manufacturer Antibodies.com
Amount 100 ul
Category
Type Antibody Primary
Format Liquid
Applications WB, IHC
Clone Assigned #A10832
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Sequence AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Available
Storage Conditions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description
Rabbit polyclonal antibody to p38 alpha / MAPK14.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human p38 MAPK (NP_620581.1).
Manufacturer - Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Purification
Affinity purification.
Recommended dilutions
WB: 1:500-1:2, 000, IHC: 1:50-1:200
Molecular weight
41 kDa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close