« Back
Home /
PPP2CA Antibody - middle region

PPP2CA Antibody - middle region

Item no.	ARP76479_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Protein Aggregation, Clearance & Misfolding Antibodies Immunoprecipitation Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IP
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	SIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQ
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RP-C,PP2Ac,PP2CA,NEDLBA,PP2Calpha
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	36 kDa
Species Tested	Human, Mouse
Gene symbol	PPP2CA
Gene Fullname	Protein phosphatase 2, catalytic subunit, alpha isozyme
Protein size	167
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.
Nucleotide accession_num	NM_002715.2
Protein accession_num	NP_002706.1
Protein name	serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human PPP2CA
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer