Comparison

MAPK14 Antibody - C-terminal region

Item no. ARP86759_P050
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens)
Host Rabbit
Sequence AAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISF
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RK,p38,CSBP,EXIP,Mxi2,CSBP1,CSBP2,CSPB1,PRKM14,PRKM15,SAPK2A,p38ALPHA
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Cancer, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
39 kDa
Species Tested
Human
Gene symbol
MAPK14
Gene Fullname
mitogen-activated protein kinase 14
Protein size
360
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Nucleotide accession_num
NM_001315.2
Protein accession_num
NP_001306.1
Protein name
Mitogen-activated protein kinase 14
Clonality
Polyclonal
Purification
Affinity purified
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK14
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close