MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(2F6), CF488A conjugate, 0.1mg/mL

IHC, FFPE (verified)

MAP3K1

Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.

Store at 2 to 8°C|Protect fluorescent conjugates from light

Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.

2 years

41116161

0.05% sodium azide (CAS 26628-22-8)

PBS, 0.1% BSA, 0.05% azide

Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

For research use only (RUO)

653654

Cytoplasmic

MAP3K1