Comparison

MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(2F6), 0.2mg/mL

Item no. B-BNUB0316-100
Manufacturer Biotium
Amount 100 uL
Quantity options 100 uL 500 uL
Category
Type Antibody Monoclonal
Format Liquid
Applications IHC
Clone 2F6
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a Kappa
Conjugate/Tag BSA
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias MEKK1,MEK Kinase 1,MEKK,SRXY6,MAPKKK1
Shipping Condition Room temperature
Available
Manufacturer - Type
Primary
Manufacturer - Applications
IHC, FFPE (verified)
Manufacturer - Category
Primary Antibodies Only
Manufacturer - Targets
MAP3K1
Manufacturer - Conjugate / Tag
Purified, with BSA
Manufacturer - Host
Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.
Shipping Temperature
Room temperature
Storage Conditions
Store at 2 to 8°C|Protect fluorescent conjugates from light
2°C to 8°C
Molecular Weight
195 kDa (intact); 80 kDa (cleaved)
Description
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Product origin
Animal
Ingredient of biological origin
Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.
Undated stability guarantee in PI
2 years
Stability at RT during shipping (protected from light)
Stable at room temperature or 37°C (98°F) for 7 days.
UNSPSC Commodity
41116161
UNSPSC Commodity Title
Primary and secondary antibodies for multiple methodology
immunostaining detection application
Classified or regulated chemicals
PBS, 0.05% BSA, 0.05% sodium azide (CAS 26628-22-8)
Concentration
0.2 mg/mL
Storage buffer
PBS, 0.05% BSA, 0.05% azide
Dated shelf life printed on label
Guaranteed for at least 24 months from date of receipt when stored as recommended
Immunogen (Secondaries, for anti tag only)
Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Clonality
Monoclonal
Regulatory Status
For research use only (RUO)
Human Gene Symbol
MAP3K1
Unigene
653654
Positive Control
A431, HeLa or HL-60 cells. Liver tissue.
Antibody target cellular localization
Cytoplasmic
Antibody applications
IHC, FFPE (verified)
Verified antibody applications
IHC (FFPE) (verified)
Antibody application notes
Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody|Immunohistochemistry (formalin-fixed): 1-2 ug/mL for 30 minutes at RT|Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM Tris buffer with 1 mM EDTA pH 9.0 for 10-20 minutes followed by cooling at RT for 20 minutes|Western Blot 0.5-1 ug/mL|Optimal dilution for a specific application should be determined by user
Manufacturer - Antibody Reactivity
MAP3K1
Antibody number
#0316

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?