Comparison

M-CSF Receptor Antibody (Phospho-Tyr723)

Item no. OAAF07477
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence QDPEGGVDYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQ
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias BANDDOS;CD115;CD115 antigen;C-FMS;CSF-1 receptor;CSF-1R;CSFR;FIM2;FMS;FMS proto-oncogene;HDLS;macrophage colony stimulating factor I receptor;macrophage colony-stimulating factor 1 receptor;McDonough feline sarcoma viral (v-fms) oncogene homolog;M-CSF-R;proto-oncogene c-Fms.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
107 kDa
Manufacturer - Application Additional Information
WB: 1:500~1000
IHC: 1:50~100
ELISA: 1:5000
Gene symbol
CSF1R
Gene Fullname
colony stimulating factor 1 receptor
Product format
Liquid PBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
Reconstitution and storage
-20°C
Description of target
Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1, 4, 5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor.
Protein name
Macrophage colony-stimulating factor 1 receptor
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human M-CSF Receptor around the phosphorylation site of Tyr723.
Manufacturer - Specificity
M-CSF Receptor (Phospho-Tyr723) Antibody detects endogenous levels of M-CSF Receptor only when phosphorylated at Tyr723.
Concentration
1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close