« Back
Home /
p57 Kip2 Antibody (Phospho-Thr310)

p57 Kip2 Antibody (Phospho-Thr310)

Item no.	OAAF07585
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Lymphoma Myeloma Melanoma Sarcoma Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Stem Cell Markers Immunochemistry
Type	Antibody Polyclonal
Applications	WB, IF, IHC, ICC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	LSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BWCR;BWS;cyclin-dependent kinase inhibitor 1C;cyclin-dependent kinase inhibitor 1C (p57,Kip2);cyclin-dependent kinase inhibitor p57;KIP2;p57;p57Kip2;WBS.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunocytochemistry\|Immunofluorescence\|Immunohistochemistry\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	32 kDa
Manufacturer - Application Additional Information	WB: 1:500~1:1000 IHC: 1:50~1:100 IF: 1:100~1:500 ELISA: 1:1000
Gene symbol	CDKN1C
Gene Fullname	cyclin dependent kinase inhibitor 1C
Reconstitution and storage	-20°C
Description of target	Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.
Protein name	Cyclin-dependent kinase inhibitor 1C
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human p57 Kip2 around the phosphorylation site of Thr310.
Manufacturer - Specificity	p57 Kip2 (Phospho-Thr310) Antibody detects endogenous levels of p57 Kip2 only when phosphorylated at Thr310.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF07585-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/29/2026

Express Delivery: Save 20 days

Compare

Add to wishlist

Get an offer