Comparison

DRP-2 Antibody (Phospho-Thr514)

Item no. OAAF07653
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Applications WB, IF, IHC, ICC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence KRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAP
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Collapsin response mediator protein 2;collapsin response mediator protein hCRMP-2;CRMP2;CRMP-2;DHPRP2;dihydropyrimidinase-related protein 2;DRP2;DRP-2;N2A3;ULIP2;ULIP-2;unc-33-like phosphoprotein 2.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
62 kDa
Manufacturer - Application Additional Information
WB: 1:500~1:1000
IHC: 1:50~1:100
IF: 1:100~1:500
ELISA: 1:5000
Gene symbol
DPYSL2
Gene Fullname
dihydropyrimidinase like 2
Reconstitution and storage
-20°C
Description of target
Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. May play a role in endocytosis.
Protein name
Dihydropyrimidinase-related protein 2
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human DRP-2 around the phosphorylation site of Thr514.
Manufacturer - Specificity
DRP-2 (Phospho-Thr514) Antibody detects endogenous levels of DRP-2 only when phosphorylated at Thr514.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close