« Back
Home /
CREB Antibody (Phospho-Ser129)

CREB Antibody (Phospho-Ser129)

Item no.	OAAF07699
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Molecular Targets for Neuroscience Neural Signaling Antibodies Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Type	Antibody Polyclonal
Applications	WB, IF, IHC, ICC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	LFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDA
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	active transcription factor CREB;cAMP-response element-binding protein-1;CREB;CREB-1;cyclic adenosine 3',5'-monophosphate response element binding protein;cyclic adenosine 3',5'-monophosphate response element-binding protein CREB;cyclic AMP-responsive element-binding protein 1;transactivator protein.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunocytochemistry\|Immunofluorescence\|Immunohistochemistry\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	36 kda
Manufacturer - Application Additional Information	IHC: 1:50~1:100 ELISA: 1:40000
Gene symbol	CREB1
Gene Fullname	cAMP responsive element binding protein 1
Reconstitution and storage	-20°C
Description of target	Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters. Transcription activation is enhanced by the TORC coactivators which act independently of Ser-133 phosphorylation. Involved in different cellular processes including the synchronization of circadian rhythmicity and the differentiation of adipose cells.
Protein name	Cyclic AMP-responsive element-binding protein 1
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human CREB around the phosphorylation site of Ser129.
Manufacturer - Specificity	CREB (Phospho-Ser129) Antibody detects endogenous levels of CREB only when phosphorylated at Ser129.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF07699-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/29/2026

Express Delivery: Save 20 days

Compare

Add to wishlist

Get an offer