« Back
Home /
Elk1 Antibody (Phospho-Thr417)

Elk1 Antibody (Phospho-Thr417)

Item no.	OAAF07706
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neural Lineage Markers Neural Transcription Factors Neural Signaling Antibodies Immunohistochemistry Immunoprecipitation ELISA Immunofluorescence Primary Antibodies Immunostaining Neuronal Cell Markers
Type	Antibody Polyclonal
Applications	IF, IP, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	WSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ELK1,ETS transcription factor;ELK1,member of ETS oncogene family;ETS domain-containing protein Elk-1;ETS-like gene 1;tyrosine kinase (ELK1) oncogene.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry\|Immunohistochemistry-Paraffin\|Immunoprecipitation
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	44 kDa
Manufacturer - Application Additional Information	IHC: 1:50~1:100 ELISA: 1:10000
Gene symbol	ELK1
Gene Fullname	ETS transcription factor ELK1
Reconstitution and storage	-20°C
Description of target	Transcription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2. Induces target gene transcription upon JNK-signaling pathway stimulation (By similarity).
Protein name	ETS domain-containing protein Elk-1
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human Elk1 around the phosphorylation site of Thr417.
Manufacturer - Specificity	Elk1 (Phospho-Thr417) Antibody detects endogenous levels of Elk1 only when phosphorylated at Thr417.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF07706-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer