« Back
Home /
GAP43 Antibody (Phospho-Ser41)

GAP43 Antibody (Phospho-Ser41)

Item no.	OAAF07713
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Development Antibodies ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Type	Antibody Polyclonal
Applications	IF, ICC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	TKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKD
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	axonal membrane protein GAP-43;B-50;calmodulin-binding protein P-57;GAP-43;Growth-associated protein 43;nerve growth-related peptide GAP43;neural phosphoprotein B-50;neuromodulin;neuron growth-associated protein 43;PP46;protein F1.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	24 kDa
Manufacturer - Application Additional Information	IF: 1:100~1:500 ELISA: 1:20000
Gene symbol	GAP43
Gene Fullname	growth associated protein 43
Reconstitution and storage	-20°C
Description of target	This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction.
Protein name	Neuromodulin
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human GAP43 around the phosphorylation site of Ser41.
Manufacturer - Specificity	GAP43 (Phospho-Ser41) Antibody detects endogenous levels of GAP43 only when phosphorylated at Ser41.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF07713-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/29/2026

Express Delivery: Save 20 days

Compare

Add to wishlist

Get an offer