Comparison

NF-kappaB p100/p52 Antibody (Phospho-Ser865)

Item no. OAAF07752
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IF, IP, IHC, ICC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence EALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGP
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CVID10;DNA-binding factor KBF2;H2TF1;lymphocyte translocation chromosome 10 protein;LYT10;LYT-10;NFKB,p52/p100 subunit;NF-kB2;nuclear factor Kappa-B,subunit 2;nuclear factor NF-kappa-B p100 subunit;nuclear factor NF-kappa-B p52 subunit;nuclear factor of Kappa light chain gene enhancer in B cells 2;Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2;nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100);oncogene Lyt-10;p100;p49/p100;p52;transcription factor NFKB2.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin|Immunoprecipitation|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
96 kDa
Manufacturer - Application Additional Information
WB: 1/500 - 1/2000IHC: 1/100 - 1/300IP: 2-5 ug/mg lysate.IF: 1/200 - 1/1000ELISA: 1/20000
Gene symbol
NFKB2
Gene Fullname
nuclear factor kappa B subunit 2
Product format
Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
Reconstitution and storage
-20°C
Description of target
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. In a non-canonical activation pathway, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa-B RelB-p52 complexes. The NF-kappa-B heterodimeric RelB-p52 complex is a transcriptional activator. The NF-kappa-B p52-p52 homodimer is a transcriptional repressor. NFKB2 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p100 and generation of p52 by a cotranslational processing. The proteasome-mediated process ensures the production of both p52 and p100 and preserves their independent function. p52 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. p52 and p100 are respectively the minor and major form; the processing of p100 being relatively poor. Isoform p49 is a subunit of the NF-kappa-B protein complex, which stimulates the HIV enhancer in synergy with p65. In concert with RELB, regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.
Protein name
Nuclear factor NF-kappa-B p100 subunit
Clonality
Polyclonal
Purification
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
Immunogen
The antiserum was produced against synthesized peptide derived from human NF-kappaB p100/p52 around the phosphorylation site of Ser865.
Manufacturer - Specificity
Phospho-NFkB-p100 (S865) Polyclonal Antibody detects endogenous levels of NFkB-p100 protein only when phosphorylated at S865.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close