Comparison

Tau Antibody (Phospho-Ser356)

Item no. OAAF07795
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Applications WB, IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence SLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIET
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DDPAC;FTDP-17;G protein beta1/gamma2 subunit-interacting factor 1;MAPTL;microtubule-associated protein tau;MSTD;MTBT1;MTBT2;neurofibrillary tangle protein;paired helical filament-tau;PHF-tau;PPND;PPP1R103;protein phosphatase 1,regulatory subunit 103;TAU;tau-40.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
78 kDa
Manufacturer - Application Additional Information
WB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:40000
Gene symbol
MAPT
Gene Fullname
microtubule associated protein tau
Reconstitution and storage
-20°C
Description of target
Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by TAU/MAPT localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
Protein name
Microtubule-associated protein tau
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human Tau around the phosphorylation site of Ser356.
Manufacturer - Specificity
Tau (Phospho-Ser356) Antibody detects endogenous levels of Tau only when phosphorylated at Ser356.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close