Comparison

MCM6 Antibody

Item no. OAAF08077
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence VKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTT
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DNA replication licensing factor MCM6;MCG40308;MCM6 minichromosome maintenance deficient 6 (MIS5 homolog,S. pombe);minichromosome maintenance deficient (mis5,S. pombe) 6;Mis5;P105MCM.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
92 kDa
Manufacturer - Application Additional Information
WB: 1/500 - 1/2000ELISA: 1/20000
Gene symbol
MCM6
Gene Fullname
minichromosome maintenance complex component 6
Product format
Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
Reconstitution and storage
Store at -20°C for 1 year.
Description of target
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
Protein name
DNA replication licensing factor MCM6
Clonality
Polyclonal
Purification
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from the Internal region of human MCM6. AA range:331-380
Manufacturer - Specificity
MCM6 Antibody detects endogenous levels of MCM6 protein.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close