« Back
Home /
CD59 Antibody

CD59 Antibody

Item no.	OAAF08099
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neuroinflammation Antibodies Flow Cytometry Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	CLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	16.3A5;1F5;1F5 antigen;20 kDa homologous restriction factor;CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5,EJ16,EJ30,EL32 and G344);CD59 blood group antigen;CD59 glycoprotein;CD59 molecule,complement regulatory protein;EJ16;EJ30;EL32;G344;HRF20;HRF-20;human leukocyte antigen MIC11;Ly-6-like protein;lymphocytic antigen CD59/MEM43;MACIF;MAC-inhibitory protein;MAC-IP;MEM43;MEM43 antigen;membrane attack complex (MAC) inhibition factor;membrane attack complex inhibition factor;membrane inhibitor of reactive lysis;MIC11;MIN1;MIN2;MIN3;MIRL;MSK21;p18-20;protectin;surface anitgen recognized by monoclonal antibody 16.3A5;T cell-activating protein.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	14 kDa
Manufacturer - Application Additional Information	WB 1:500~1000 ELISA 1:10000
Gene symbol	CD59
Gene Fullname	CD59 molecule (CD59 blood group)
Product format	Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Reconstitution and storage	-20°C
Description of target	Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.
Protein name	CD59 glycoprotein
Clonality	Polyclonal
Purification	The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from the Internal region of human CD59.
Manufacturer - Specificity	CD59 Antibody detects endogenous levels of CD59 protein.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF08099-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/29/2026

Express Delivery: Save 20 days

Compare

Add to wishlist

Get an offer