Comparison

CAMK2A Antibody

Item no. OAAL00037
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, ELISA
Clone 1H7
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2a Kappa
Sequence TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha;calcium/calmodulin-dependent protein kinase II alpha-B subunit;calcium/calmodulin-dependent protein kinase type II alpha chain;calcium/calmodulin-dependent protein kinase type II subunit alpha;CaM kinase II alpha subunit;caM kinase II subunit alpha;CAMKA;CaMK-II alpha subunit;caMK-II subunit alpha;CaMKIIalpha;CaMKIINalpha;CaM-kinase II alpha chain;MRD53;MRT63.
Shipping Condition Cool pack
Available
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
CAMK2A
Gene Fullname
calcium/calmodulin dependent protein kinase II alpha
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Nucleotide accession_num
BC040457
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/AAH40457
Protein name
Calcium/calmodulin-dependent protein kinase II alpha [Homo sapiens]|Homo sapiens calcium/calmodulin-dependent protein kinase II alpha, mRNA (cDNA clone MGC:26106 IMAGE:4811948), complete cds
Clonality
Monoclonal
Immunogen
CAMK2A (AAH40457, 305 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close