Comparison

GLI3 Antibody

Item no. OAAL00124
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, ELISA
Clone 1H7
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2b Kappa
Sequence MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias ACLS;GCPS;GLI3-190;GLI3FL;GLI-Kruppel family member GLI3;glioma-associated oncogene family zinc finger 3;oncogene GLI3;PAPA;PAP-A;PAPA1;PAPB;PHS;PPDIV;transcriptional activator GLI3;zinc finger protein GLI3.
Shipping Condition Cool pack
Available
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
GLI3
Gene Fullname
GLI family zinc finger 3
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B. [provided by RefSeq
Nucleotide accession_num
NM_000168
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/NP_000159
Protein name
Homo sapiens GLI family zinc finger 3 (GLI3), mRNA|transcriptional activator GLI3 [Homo sapiens]
Clonality
Monoclonal
Immunogen
GLI3 (NP_000159, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close