Comparison

MBD1 Antibody

Item no. OAAL00187
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, IHC, ELISA
Clone 2C7
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2b Kappa
Sequence HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CXXC3;CXXC-type zinc finger protein 3;methyl-CpG-binding domain protein 1;PCM1;protein containing methyl-CpG-binding domain 1;RFT;the regulator of fibroblast growth factor 2 (FGF-2) transcription.
Shipping Condition Cool pack
Available
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
MBD1
Gene Fullname
methyl-CpG binding domain protein 1
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21. [provided by RefSeq
Nucleotide accession_num
NM_015846
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/NP_056671
Protein name
Homo sapiens methyl-CpG binding domain protein 1 (MBD1), transcript variant 1, mRNA|methyl-CpG-binding domain protein 1 isoform 1 [Homo sapiens]
Clonality
Monoclonal
Immunogen
MBD1 (NP_056671, 415 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close