« Back
Home /
MCM3 Antibody

MCM3 Antibody

Item no.	OAAL00189
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neural Lineage Markers Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IF, ELISA
Clone	2H3
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	cervical cancer proto-oncogene 5;DNA polymerase alpha holoenzyme-associated protein P1;DNA replication factor MCM3;DNA replication licensing factor MCM3;HCC5;hRlf beta subunit;MCM3 minichromosome maintenance deficient 3;minichromosome maintenance deficient 3;P1.h;p102;P1-MCM3;replication licensing factor,beta subunit;RLF subunit beta;RLFB.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	MCM3
Gene Fullname	minichromosome maintenance complex component 3
Product format	Liquid. PBS, pH 7.4
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq
Nucleotide accession_num	NM_002388
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_002379
Protein name	DNA replication licensing factor MCM3 isoform 1 [Homo sapiens]\|Homo sapiens minichromosome maintenance complex component 3 (MCM3), transcript variant 1, mRNA
Clonality	Monoclonal
Immunogen	MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00189-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer