« Back
Home /
NFATC2 Antibody

NFATC2 Antibody

Item no.	OAAL00213
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Aging & Neurological Disorders Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	2A4
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTRLSWIQNIL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	NFAT pre-existing subunit;NFAT transcription complex,preexisting component;NFAT1;NF-ATc2;NFATP;nuclear factor of activated T-cells,cytoplasmic 2;nuclear factor of activated T-cells,cytoplasmic,calcineurin-dependent 2;nuclear factor of activated T-cells,preexisting component;preexisting nuclear factor of activated T-cells 2;T cell transcription factor NFAT1.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	NFATC2
Gene Fullname	nuclear factor of activated T cells 2
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Nucleotide accession_num	NM_012340
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_036472
Protein name	Homo sapiens nuclear factor of activated T cells 2 (NFATC2), transcript variant 1, mRNA\|nuclear factor of activated T-cells, cytoplasmic 2 isoform B [Homo sapiens]
Clonality	Monoclonal
Immunogen	NFATC2 (NP_036472, 812 a.a. ~ 921 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00213-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer