« Back
Home /
PIK3CA Antibody

PIK3CA Antibody

Item no.	OAAL00240
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Adenocarcinoma Mesothelioma Flow Cytometry Immunohistochemistry Western Blot ELISA Autophagy Cardiovascular Research Proliferation Myocardial Infarction Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	ELISA
Clone	3G3
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CLAPO;CLOVE;CWS5;MCAP;MCM;MCMTC;mutant phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha;p110-alpha;phosphatidylinositol 3-kinase,catalytic,110-KD,alpha;phosphatidylinositol 3-kinase,catalytic,alpha polypeptide;phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform;phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;phosphoinositide 3-kinase alpha;phosphoinositide-3-kinase,catalytic,alpha polypeptide;PI3K;PI3K-alpha;PI3-kinase p110 subunit alpha;ptdIns-3-kinase subunit p110-alpha;serine/threonine protein kinase PIK3CA.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Proximity ligation assay
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	PIK3CA
Gene Fullname	phosphatidylinositol-4, 5-bisphosphate 3-kinase catalytic subunit alpha
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	Phosphatidylinositol 3-kinase is composed of an 85 kDa regulatory subunit and a 110 kDa catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4, 5)P2. This gene has been found to be oncogenic and has been implicated in cervical cancers. [provided by RefSeq
Nucleotide accession_num	NM_006218
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_006209
Protein name	Homo sapiens phosphatidylinositol-4, 5-bisphosphate 3-kinase catalytic subunit alpha (PIK3CA), mRNA\|phosphatidylinositol 4, 5-bisphosphate 3-kinase catalytic subunit alpha isoform [Homo sapiens]
Clonality	Monoclonal
Immunogen	PIK3CA (NP_006209, 959 a.a. ~ 1068 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00240-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer