« Back
Home /
MED1 Antibody

MED1 Antibody

Item no.	OAAL00252
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	1G3
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	activator-recruited cofactor 205 kDa component;ARC205;CRSP1;CRSP200;DRIP205;DRIP230;mediator of RNA polymerase II transcription subunit 1;p53 regulatory protein RB18A;PBP;peroxisome proliferator-activated receptor-binding protein;PPAR-binding protein;PPARBP;PPARG binding protein;PPARGBP;RB18A;thyroid hormone receptor-associated protein complex 220 kDa component;thyroid hormone receptor-associated protein complex component TRAP220;thyroid receptor interacting protein 2;TRAP220;TR-interacting protein 2;TRIP2;TRIP-2;vitamin D receptor-interacting protein 230 kD;vitamin D receptor-interacting protein complex component DRIP205.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	MED1
Gene Fullname	mediator complex subunit 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. [provided by RefSeq
Nucleotide accession_num	NM_004774
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_004765
Protein name	Homo sapiens mediator complex subunit 1 (MED1), mRNA\|mediator of RNA polymerase II transcription subunit 1 [Homo sapiens]
Clonality	Monoclonal
Immunogen	PPARBP (NP_004765, 1391 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00252-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/29/2026

Express Delivery: Save 20 days

Compare

Add to wishlist

Get an offer