« Back
Home /
IL23R Antibody

IL23R Antibody

Item no.	OAAL00930
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers Neural Transcription Factors Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Culture Cytokines Cell Status Adenocarcinoma Myelofibrosis Western Blot ELISA Senescence Primary Antibodies Astrocytoma By Organ Bladder Cancer Immunostaining Bone Cancer
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	1G12
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	LNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLE
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	IL-23 receptor;interleukin-23 receptor.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	IL23R
Gene Fullname	interleukin 23 receptor
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is a subunit of the receptor for IL23A/IL23. This protein pairs with the receptor molecule IL12RB1/IL12Rbeta1, and both are required for IL23A signaling. This protein associates constitutively with Janus kinase 2 (JAK2), and also binds to transcription activator STAT3 in a ligand-dependent manner. [provided by RefSeq
Nucleotide accession_num	NM_144701
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_653302
Protein name	Homo sapiens interleukin 23 receptor (IL23R), mRNA\|interleukin-23 receptor precursor [Homo sapiens]
Clonality	Monoclonal
Immunogen	IL23R (NP_653302, 553 a.a. ~ 628 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00930-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer