Comparison

PAX6 Antibody

Item no. OAAN02229
Manufacturer AVIVA Systems Biology
Amount 50 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IF, IP, IHC, ICC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Sequence ISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASN
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias AN,AN1,AN2,FVH1,MGDA,WAGR,ASGD5,D11S812E
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
47 kDa
Manufacturer - Application Additional Information
WB: 1:500~1000IF/ICC: 1:50~200IP: 1:50~200
Gene symbol
PAX6
Gene Fullname
paired box 6
Product format
Liquid PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Reconstitution and storage
Store at -20°C. Avoid repeated freeze/thaw cycles.
Description of target
This gene encodes a homeobox and paired domain-containing protein that binds DNA and functions as a regulator of transcription. Activity of this protein is key in the development of neural tissues, particularly the eye. This gene is regulated by multiple enhancers located up to hundreds of kilobases distant from this locus. Mutations in this gene or in the enhancer regions can cause ocular disorders such as aniridia and Peter' s anomaly. Use of alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms.
Nucleotide accession_num
NM_000280.4
Protein accession_num
NP_000271.1
Protein name
Paired box protein Pax-6
Clonality
Polyclonal
Purification
Affinity purified against immunogen
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 190-280 of human PAX6 (NP_000271.1).
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Delivery expected until 12/11/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close