Comparison

GJA3 Antibody - N-terminal region (OABB02079)

Item no. OABB02079
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Format Lyophilized
Applications WB
Specific against other
Host Rabbit
Isotype IgG
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Available
Gene symbol
GJA3
Product format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution and storage
Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml. +4C
Description of target
Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).
Clonality
Polyclonal
Purification
Immunogen affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close