ATP2A3 Antibody - N-terminal region (OABB02107)

ATP2A3

489

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. Whata€s more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.

Immunogen affinity purified.

A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3 (1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.