C-Reactive Protein, Canine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Canine
Amount 100ug
Host Canine
ArtNr PC40321
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid
Sequence
MEKLWPCLLVLMNLPGAFLQIDLDEKAFVFPRESE NSYVILFPQLQKPMKAFTVCLQVYT DLTRPHSLF SYATKSQSNEILLFKERPGLFSVSVGGSDAFINFP QKFYAPQHFCVTWESV TGLTELWVDGKPMVRASL RRGYTVGSGASIVLGQEQDSFGGGFDKNQSLVGDI EDVNMWD FVLSPSQILTLYTTRALSPNVLNWRNL RYETRGEVFLKKELWS
Storage
-60C or below
Associated Disease
Cardiovascular
Entrez Gene
488629
Omim
123260
Swiss Prot
T2KEN6
Unigene
Cfa.48374
Molecular Weight
25 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close