Fibronectin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PF10451
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
Liquid in 10 mM HEPES/0.15 M NaCl/pH 7.5

(pH 7.2 + 0.3) containing 0.15 % Sodium Azide
Sequence
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQ MVQPQSPVAVSQSKPGCYDNGKHYQ INQQWERTY LGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGN TYRVGDTYERPKDSMI WDCTCIGAGRGRISCTIA NRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNG KGEWTCK PIAEKCFDHAAGTSYVVGETWEKPYQG WMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY R IGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSV QTTSSGSGPFTDVRAAVYQPQPHP QPPPYGHCVT DSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQET AVTQTYGGNSNGEPC VLPFTYNGRTFYSCTTEGR QDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGN SNGALC HFPFLYNNHNYTDCTSEGRRDNMKWCGT TQNYDADQKFGFCPMAAHEEICTTNEGVMYRI GD QWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQ CIVDDITYNVNDTFHKRHEEGHM LNCTCFGQGRG RWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQ CYCYGRGIGEWHCQ PLQTYPSSSGPVEVFITETP SQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWK EATIP GHLNSYTIKGLKPGVVYEGQLISIQQYGH QEVTRFDFTTTSTSTPVTSNTVTGETTPFSP LVA TSESVTEITASSFVVSWVSASDTVSGFRVEYELSE EGDEPQYLDLPSTATSVNIPDL LPGRKYIVNVYQ ISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSI VVRWSRPQAPITG YRIVYSPSVEGSSTELNLPET ANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQ ETTG TPRSDTVPSPRDLQFVEVTDVKVTIMWTPP ESAVTGYRVDVIPVNLPGEHGQRLPISRNT FAEV TGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDA PTNLQFVNETDSTVLVRWTPP RAQITGYRLTVGL TRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVA IKGNQESPKATG VFTTLQPGSSIPPYNTEVTETT IVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGS IVV SGLTPGVEYVYTIQVLRDGQERDAPIVNKVV TPLSPPTNLHLEANPDTGVLTVSWERSTT PDITG YRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPG LEYNVSVYTVKDDKESVPIS DTIIPAVPPPTDLR FTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEE DVAELSISPSD NAVVLTNLLPGTEYVVSVSSVYE QHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHW IA PRATITGYRIRHHPEHFSGRPREDRVPHSRNS ITLTNLTPGTEYVVSIVALNGREESPLL IGQQST VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRIT YGETGGNSPVQEFTVPGSK STATISGLKPGVDYT ITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQV TDVQDNSISV KWLPSSSPVTGYRVTTTPKNGPGP TKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSG E SQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWE SPQGQVSRYRVTYSSPEDGIHELFPAP DGEEDTA ELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAI PAPTDLKFTQVTPTSLSA QWTPPNVQLTGYRVRV TPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVS VYALKDTLT SRPAQGVVTTLENVSPPRRARVTDA TETTITISWRTKTETITGFQVDAVPANGQTPIQRT IKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSP VVIDASTAIDAPSNLRFLATTPNSLL VSWQPPRA RITGYIIKYEKPGSPPREVVPRPRPGVTEATITGL EPGTEYTIYVIALKNNQ KSEPLIGRKKTDELPQL VTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDTGN GIQLPGTS GQQPSVGQQMIFEEHGFRRTTPPTTA TPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIIS CHPVGTDEEPLQFRVPGTSTSATLT GLTRGATYN VIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDD SCFDPYTVSHYAVGDE WERMSESGFKLLCQCLGF GSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQM MSCTCLG NGKGEFKCDPHEATCYDDGKTYHVGEQ WQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEP S PEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLD VQADREDSRE
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
2335
Omim
135600
Swiss Prot
P02751
Unigene
Hs.203717
Molecular Weight
440 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close