Haptoglobin, Canine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Canine
Amount 0.1mg
Host Canine
ArtNr PH30661
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
10 mM TrisCl pH 7.4, 150 mM NaCl,
Sequence
EDTGSEATNNTEVSLPKPPVIENGYVEHMIRYQCK PFYKLHTEGDGVYTLNSEKHWTNKA VGEKLPECE AVCGKPKNPVDQVQRIMGGSVDAKGSFPWQAKMVS HHNLTSGATLINEQWL LTTAKNLFLGHKDDAKAN DIAPTLKLYVGKNQLVEVEKVVLHPDYSKVDIGLI KLKQKVP IDERVMPICLPSKDYAEVGRIGYVSGW GRNSNFNFTELLKYVMLPVADQDKCVQHYEGST V PEKKSPKSPVGVQPILNEHTFCAGMSKFQEDTCYG DAGSAFAVHDQDEDTWYAAGILSF DKSCTVAEYG VYVKVPSVLAWVQETIAGN
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
479668
Omim
140100
Swiss Prot
P19006
Molecular Weight
36 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close