Fibronectin, Mouse

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Mouse
Amount 1mg
Host Mouse
ArtNr PF50481
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
Liquid in 10 mM HEPES/0.15 M NaCl/pH 7.5

(pH 7.2 + 0.3) containing 0.15 % Sodium Azide
Sequence
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQ QIVQPQSPVAVSQSKPGCFDNGKHY QINQQWERT YLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTG NTYKVGDTYERPKDSM IWDCTCIGAGRGRISCTI ANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGN GKGEWTC KPIAEKCFDHAAGTSYVVGETWEKPYQ GWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS Y RIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHAL QSASAGSGSFTDVRTAIYQPQTHP QPAPYGHCVT DSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQET AVTQTYGGNSNGEPC VLPFTYNGRTFYSCTTEGR QDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGN SNGALC HFPFLYNNRNYTDCTSEGRRDNMKWCGT TQNYDADQKFGFCPMAAHEEICTTNEGVMYRI GD QWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQ CIVDDITYNVNDTFHKRHEEGHM LNCTCFGQGRG RWKCDPIDQCQDSETRTFYQIGDSWEKFVHGVRYQ CYCYGRGIGEWHCQ PLQTYPGTTGPVQVIITETP SQPNSHPIQWNAPEPSHITKYILRWRPKTSTGRWK EATIP GHLNSYTIKGLTPGVIYEGQLISIQQYGH REVTRFDFTTSASTPVTSNTVTGETAPYSPV VAT SESVTEITASSFVVSWVSASDTVSGFRVEYELSEE GDEPQYLDLPSTATSVNIPDLL PGRKYIVNVYQI SEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIV VRWSRPQAPITGY RIVYSPSVEGSSTELNLPETA NSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQE TTGT PRSDNVPPPTDLQFVELTDVKVTIMWTPPD SVVSGYRVEVLPVSLPGEHGQRLPVNRNTF AEIT GLSPGVTYLFKVFAVHQGRESNPLTAQQTTKLDAP TNLQFVNETDRTVLVTWTPPR ARIAGYRLTAGLT RGGQPKQYNVGPLASKYPLRNLQPGSEYTVTLVAV KGNQQSPKATGV FTTLQPLRSIPPYNTEVTETTI VITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSI VVS GLTPGVEYTYTIQVLRDGQERDAPIVNRVVT PLSPPTNLHLEANPDTGVLTVSWERSTTP DITGY RITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGL EYNVSVYTVKDDKESAPISD TVVPEVPQLTDLSF VDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIP IFEDFVDSSVG YYTVTGLEPGIDYDISVITLING GESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWA PP PSIELTNLLVRYSPVKNEEDVAELSISPSDNA VVLTNLLPGTEYLVSVSSVYEQHESIPL RGRQKT GLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIR HHAEHSVGRPRQDRVPPSR NSITLTNLNPGTEYV VSIIAVNGREESPPLIGQQATVSDIPRDLEVIAST PTSLLISWEP PAVSVRYYRITYGETGGNSPVQEF TVPGSKSTATINNIKPGADYTITLYAVTGRGDSPA S SKPVSINYKTEIDKPSQMQVTDVQDNSISVRWL PSTSPVTGYRVTTTPKNGLGPSKTKTA SPDQTEM TIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNI DRPKGLAFTDVDVDSIKI AWESPQGQVSRYRVTY SSPEDGIRELFPAPDGEDDTAELQGLRPGSEYTVS VVALHDDME SQPLIGIQSTAIPAPTNLKFSQVTP TSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINL SPDSSSVIVSGLMVATKYEVSVYALKDTLTSRPA QGVITTLENVSPPRRARVTDATETTI TISWRTKT ETITGFQVDAIPANGQTPVQRSISPDVRSYTITGL QPGTDYKIHLYTLNDNA RSSPVIIDASTAIDAPS NLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGS PPREVVPR PRPGVTEATITGLEPGTEYTIYVIAL KNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEI LDVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPS VGQQMIFEEHGFRRTTPPTAATPVR LRPRPYLPN VDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQE ALSQTTISWTPFQESS EYIISCQPVGTDEEPLQF QVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKV REEVVTV GNAVSEGLNQPTDDSCFDPYTVSHYAI GEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKW C HDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEF KCDPHEATCYDDGKTYHVGEQWQK EYLGAICSCT CFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYT QRYNQRTNTNVNCPI ECFMPLDVQADRDDSRE
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
14268
Omim
135600
Swiss Prot
P11276
Unigene
Mm.193099
Molecular Weight
440 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close