« Back
Home /
Research Area /
Metabolism /
Human Apolipoprotein A-II (Apo A2)

Human Apolipoprotein A-II (Apo A2)

Item no.	PA20021
Manufacturer	Assaypro
Amount	200 ug
Category	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Obesity Lipid & Fatty Acid Transport
Type	Proteins
Specific against	Human (Homo sapiens)
Host	Human
Purity	>90% by SDS-PAGE
Sequence	MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVS QYFQTVTDYGKDLMEKVKSPELQAE AKSYFEKSK EQLTPLIKKAGTELVNFLSYFVELGTQPATQ
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	Apolipoprotein AII
Available
Manufacturer - Type	Proteins
Manufacturer - Category	Proteins
Storage Conditions	-60C or below
Molecular Weight	17 kDa
Associated Disease	Cardiovascular, Cancer, Heart Disease
Omim	107670
Presentation	Liquid in 10 mM NH4HCO3, pH 7.4
Unigene	Hs.237658
Format	Purified Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 12/18/2025

Express Delivery: Save 20 days

Compare

Add to wishlist

Get an offer