Apolipoprotein AII, High Density, Human Plasma

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 500ug
Host Human
ArtNr PA20021
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 10 mM NH4HCO3, pH 7.4
Sequence
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVS QYFQTVTDYGKDLMEKVKSPELQAE AKSYFEKSK EQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Storage
-60C or below
Associated Disease
Cardiovascular, Cancer, Heart Disease
Entrez Gene
336
Omim
107670
Swiss Prot
P02652
Unigene
Hs.237658
Molecular Weight
17 kDa
Amount: 500ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close