Apolipoprotein CI, Human Plasma, Very Low Density Lipoprotein

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ug
Host Human
ArtNr PA20051
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 10 mM NH4HCO3, pH 7.4
Sequence
TPDVSSALDKLKEFGNTLEDKARELISRIKQSELS AKMREWFSETFQKVKEKLKIDS
Storage
-60C or below
Associated Disease
Cardiovascular, Cancer, Heart Disease
Entrez Gene
341
Omim
107710
Swiss Prot
P02654
Unigene
Hs.110675
Molecular Weight
7 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close