Factor X, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.4mg
Host Human
ArtNr PF10102
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 1mM
Benzamidine/ pH 7.4
Sequence
MGRPLHLVLLSASLAGLLLLGESLFIRREQANNIL ARVTRANSFLEEMKKGHLERECMEE TCSYEEARE VFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDG LGEYTCTCLEGFEGKN CELFTRKLCSLDNGDCDQ FCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCG KQTLERR KRSVAQATSSSGEAPDSITWKPYDAAD LDPTENPFDLLDFNQTQPERGDNNLTRIVGGQE C KDGECPWQALLINEENEGFCGGTILSEFYILTAAH CLYQAKRFKVRVGDRNTEQEEGGE AVHEVEVVIK HNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPE RDWAESTLMTQKTGI VSGFGRTHEKGRQSTRLKM LEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQEDA CQGDSG GPHVTRFKDTYFVTGIVSWGEGCARKGK YGIYTKVTAFLKWIDRSMKTRGLPKAKSHAPE VI TSSPLK
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
2159
Omim
227600
Swiss Prot
P00742
Unigene
Hs.361463
Molecular Weight
59 kDa
Amount: 0.4mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close