Factor XIIa, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PF10118
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
4 mM Sodium Acetate-HCl/ 0.15 M NaCl, pH 5.3
Sequence
MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEE HTVVLTVTGEPCHFPFQYHRQLYHKCTHKGRPGPQ PWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQ KGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQL LRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLAS QACRTNPCLHGGRCLEVEGHRLCHCPVGYTGAFCD VDTKASCYDGRGLSYRGLARTTLSGAPCQPWASEA TYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVL NRDRLSWEYCDLAQCQTPTQAAPPTPVSPRLHVPL MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPS LTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHP YIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP EDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSP VSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSG AARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVP FLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQ GDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNK PGVYTDVAYYLAWIREHTVS
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
2161
Omim
610619
Swiss Prot
P00748
Unigene
Hs.1321
Molecular Weight
80 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close