Factor B, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 200ug
Host Human
ArtNr PF10251
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
Lyophlized
Sequence
TPWSLAWPQGSCSLEGVEIKGGSFRLLQEGQALEY VCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRK AECRAIHCPRPHDFENGEYWPRSPYYNVSDEISFH CYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYC SNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGS QRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFL SSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMN IYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGV KPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLN EINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPE GWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLY IGKDRKNPREDYLDVYVFGVGPLVNQVNINALASK KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAV VSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEI EVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNK LKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKE ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGS CERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYA DPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVC KNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDED LGFLVDHHHHHH
Storage
-60C or below
Associated Disease
Age-Related Macular Degeneration and Polypoidal Choroidal Vasculopathy
Entrez Gene
629
Omim
138470
Swiss Prot
P00751
Unigene
Hs.69771
Molecular Weight
84 kDa including tags
Amount: 200ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close