Lactoferrin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ug
Host Human
ArtNr PL50011
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 100 mM Tris-HCl, pH 8.0, with 300 mM NaCl
Sequence
MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEA TKCFQWQRNMRKVRGPPVSCIKRDS PIQCIQAIA ENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTE RQPRTHYYAVAVVKKG GSFQLNELQGLKSCHTGL RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFS ASCVPGA DKGQFPNLCRLCAGTGENKCAFSSQEP YFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDE A ERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVA RSVNGKEDAIWNLLRQAQEKFGKD KSPKFQLFGS PSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFT AIQNLRKSEEEVAAR RARVVWCAVGEQELRKCNQ WSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLD GGYVYT AGKCGLVPVLAENYKSQQSSDPDPNCVD RPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHT AV DRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSD PRSNLCALCIGDEQGENKCVPNS NERYYGYTGAF RCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLK LADFALLCLDGKRK PVTEARSCHLAMAPNHAVVS RMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQS ETKNL LFNDNTECLARLHGKTTYEKYLGPQYVAG ITNLKKCSTSPLLEACEFLRK
Storage
-60C or below
Associated Disease
Cancer, Inflammation
Entrez Gene
4057
Omim
150210
Swiss Prot
P02788
Unigene
Hs.529517
Molecular Weight
76 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close