Protein Z, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PP32012
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
Lyophlized
Sequence
MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVL VRWKRAGSYLLEELFEGNLEKECYE EICVYEEAR EVFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQD SIWGYTCTCSPGYEGS NCELAKNECHPERTDGCQ HFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCAC GVLTSEK RAPDLQDLPWQVKLTNSEGKDFCGGVI IRENFVLTTAKCSLLHRNITVKTYFNRTSQDPL M IKITHVHVHMRYDADAGENDLSLLELEWPIQCPGA GLPVCTPEKDFAEHLLIPRTRGLL SGWARNGTDL GNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSS VAAMHWMDGSVVTRE HRGSWFLTGVLGSQPVGGQ AHMVLVTKVSRYSLWFKQIMN
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
8858
Omim
176895
Swiss Prot
P22891
Unigene
Hs.1011
Molecular Weight
45 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close